Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E4G5

Protein Details
Accession A0A0D0E4G5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
36-57NSGFHNWKKRDARNKLNTDPVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7.5, cyto_mito 7.5, extr 7, cyto 6.5, pero 3
Family & Domain DBs
Amino Acid Sequences MIEAAKTLSCTFSTLQSGGTVWALPNQDDATRCYANSGFHNWKKRDARNKLNTDPVPLDVKGTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.16
4 0.16
5 0.14
6 0.14
7 0.11
8 0.07
9 0.1
10 0.1
11 0.1
12 0.11
13 0.11
14 0.12
15 0.13
16 0.14
17 0.16
18 0.16
19 0.15
20 0.16
21 0.16
22 0.16
23 0.18
24 0.23
25 0.26
26 0.32
27 0.42
28 0.42
29 0.5
30 0.56
31 0.63
32 0.67
33 0.68
34 0.74
35 0.75
36 0.82
37 0.78
38 0.8
39 0.72
40 0.68
41 0.6
42 0.52
43 0.46
44 0.37