Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HDU2

Protein Details
Accession C6HDU2   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
11-32SLQPERKKSHRVTVKKTNKTDTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, mito 5
Family & Domain DBs
Amino Acid Sequences MDSFQNRSAGSLQPERKKSHRVTVKKTNKTDTVTRRKFFQMFQRGGKTGGGPGIVRNTISYGERERASDRAPFFLLKTAVVDDSRPGRWREGDGLTEKNIIINVSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.59
4 0.63
5 0.62
6 0.64
7 0.66
8 0.66
9 0.7
10 0.75
11 0.81
12 0.81
13 0.82
14 0.77
15 0.72
16 0.68
17 0.68
18 0.67
19 0.67
20 0.66
21 0.62
22 0.59
23 0.59
24 0.56
25 0.51
26 0.5
27 0.48
28 0.45
29 0.49
30 0.49
31 0.45
32 0.44
33 0.4
34 0.3
35 0.21
36 0.17
37 0.13
38 0.09
39 0.09
40 0.1
41 0.09
42 0.09
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1
48 0.11
49 0.14
50 0.14
51 0.16
52 0.17
53 0.18
54 0.19
55 0.22
56 0.2
57 0.2
58 0.21
59 0.2
60 0.19
61 0.22
62 0.2
63 0.16
64 0.16
65 0.14
66 0.15
67 0.14
68 0.14
69 0.13
70 0.16
71 0.19
72 0.22
73 0.23
74 0.25
75 0.27
76 0.3
77 0.32
78 0.32
79 0.34
80 0.35
81 0.37
82 0.35
83 0.35
84 0.31
85 0.27
86 0.24