Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DTD0

Protein Details
Accession A0A0D0DTD0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
58-77VGQLCTKKTPTRKTGKHPGNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 7.5, nucl 6, cyto_pero 5
Family & Domain DBs
Amino Acid Sequences MNMLEEGAKGSNQQMVSIHAIRTNEVSSKVGKGGVHNVFRKKGATEAWDRVELAPTKVGQLCTKKTPTRKTGKHPGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.16
3 0.21
4 0.22
5 0.21
6 0.19
7 0.2
8 0.19
9 0.2
10 0.18
11 0.15
12 0.15
13 0.16
14 0.14
15 0.15
16 0.15
17 0.15
18 0.14
19 0.14
20 0.19
21 0.24
22 0.28
23 0.31
24 0.34
25 0.33
26 0.33
27 0.33
28 0.26
29 0.23
30 0.19
31 0.2
32 0.22
33 0.25
34 0.27
35 0.27
36 0.27
37 0.25
38 0.28
39 0.24
40 0.2
41 0.18
42 0.16
43 0.18
44 0.19
45 0.21
46 0.22
47 0.28
48 0.31
49 0.36
50 0.44
51 0.49
52 0.56
53 0.63
54 0.67
55 0.72
56 0.76
57 0.79