Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E0L1

Protein Details
Accession A0A0D0E0L1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-21EPPKPTRSSNGRPHIPRPRNBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MEPPKPTRSSNGRPHIPRPRNPFILFRCDLVHQRKMQPKSEADDNNVSRIAGELWREMTAEEKRPWLELAVKEKERHVLLYPDYKYAPSTKGKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.79
4 0.78
5 0.77
6 0.75
7 0.73
8 0.71
9 0.7
10 0.62
11 0.62
12 0.55
13 0.47
14 0.41
15 0.36
16 0.41
17 0.38
18 0.4
19 0.35
20 0.41
21 0.48
22 0.5
23 0.53
24 0.5
25 0.47
26 0.45
27 0.49
28 0.44
29 0.39
30 0.43
31 0.38
32 0.34
33 0.32
34 0.27
35 0.19
36 0.17
37 0.14
38 0.08
39 0.09
40 0.08
41 0.09
42 0.09
43 0.09
44 0.09
45 0.13
46 0.14
47 0.19
48 0.19
49 0.21
50 0.22
51 0.23
52 0.23
53 0.2
54 0.23
55 0.23
56 0.3
57 0.35
58 0.38
59 0.38
60 0.39
61 0.42
62 0.38
63 0.35
64 0.3
65 0.27
66 0.28
67 0.36
68 0.36
69 0.35
70 0.34
71 0.33
72 0.32
73 0.3
74 0.31
75 0.32