Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DWL3

Protein Details
Accession A0A0D0DWL3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
200-226DTAKSSQDSKPKEKRRKLEDRVTVTPEHydrophilic
NLS Segment(s)
PositionSequence
211-215KEKRR
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR036770  Ankyrin_rpt-contain_sf  
Amino Acid Sequences MSILVALPIELLYEIQLFAASHAFPQTCKSLHEIFRSSPPSYRAQYLIACVELSPVRDHIILTKILRYPICNQDVLEAYLRMTKVDSSRRWAPELPRRLFRSLVSKSSTSSKSVMEQRTDRDPPLPFLRYLYSCPYLQPPNVNSHDGYALTKAVQTGFIPLVRFLLDHGATPDWKNNLPVLIAIHRKDLSLVRILVERIDTAKSSQDSKPKEKRRKLEDRVTVTPEMLRTAVKCRAQDIVEYLTREKGCIPDMQTLLLMR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.08
6 0.09
7 0.09
8 0.09
9 0.12
10 0.13
11 0.12
12 0.16
13 0.2
14 0.19
15 0.2
16 0.25
17 0.29
18 0.35
19 0.42
20 0.42
21 0.4
22 0.48
23 0.51
24 0.47
25 0.44
26 0.42
27 0.41
28 0.4
29 0.4
30 0.34
31 0.32
32 0.32
33 0.3
34 0.28
35 0.23
36 0.2
37 0.16
38 0.17
39 0.15
40 0.15
41 0.13
42 0.12
43 0.14
44 0.14
45 0.14
46 0.14
47 0.16
48 0.18
49 0.18
50 0.21
51 0.21
52 0.25
53 0.25
54 0.25
55 0.28
56 0.32
57 0.34
58 0.31
59 0.29
60 0.29
61 0.3
62 0.29
63 0.25
64 0.17
65 0.14
66 0.16
67 0.16
68 0.13
69 0.12
70 0.12
71 0.16
72 0.24
73 0.25
74 0.29
75 0.37
76 0.39
77 0.42
78 0.43
79 0.46
80 0.47
81 0.55
82 0.52
83 0.53
84 0.54
85 0.53
86 0.51
87 0.44
88 0.44
89 0.38
90 0.38
91 0.35
92 0.31
93 0.3
94 0.35
95 0.34
96 0.27
97 0.25
98 0.21
99 0.23
100 0.3
101 0.31
102 0.3
103 0.3
104 0.31
105 0.36
106 0.36
107 0.32
108 0.29
109 0.26
110 0.26
111 0.29
112 0.28
113 0.21
114 0.21
115 0.23
116 0.2
117 0.21
118 0.22
119 0.19
120 0.18
121 0.19
122 0.21
123 0.21
124 0.21
125 0.22
126 0.2
127 0.24
128 0.27
129 0.28
130 0.24
131 0.22
132 0.22
133 0.19
134 0.18
135 0.12
136 0.1
137 0.08
138 0.08
139 0.08
140 0.07
141 0.07
142 0.07
143 0.08
144 0.09
145 0.1
146 0.1
147 0.1
148 0.1
149 0.09
150 0.09
151 0.08
152 0.11
153 0.1
154 0.1
155 0.12
156 0.12
157 0.13
158 0.14
159 0.17
160 0.15
161 0.16
162 0.17
163 0.16
164 0.15
165 0.14
166 0.14
167 0.13
168 0.17
169 0.2
170 0.2
171 0.23
172 0.22
173 0.22
174 0.23
175 0.23
176 0.2
177 0.2
178 0.2
179 0.17
180 0.19
181 0.19
182 0.18
183 0.16
184 0.14
185 0.11
186 0.12
187 0.12
188 0.11
189 0.16
190 0.17
191 0.2
192 0.24
193 0.31
194 0.37
195 0.46
196 0.56
197 0.62
198 0.72
199 0.77
200 0.82
201 0.84
202 0.89
203 0.88
204 0.88
205 0.87
206 0.84
207 0.8
208 0.76
209 0.67
210 0.56
211 0.49
212 0.39
213 0.31
214 0.24
215 0.19
216 0.15
217 0.21
218 0.28
219 0.3
220 0.3
221 0.3
222 0.35
223 0.34
224 0.35
225 0.33
226 0.32
227 0.31
228 0.33
229 0.32
230 0.34
231 0.33
232 0.31
233 0.28
234 0.25
235 0.23
236 0.26
237 0.28
238 0.3
239 0.3
240 0.31