Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0BP13

Protein Details
Accession A0A0D0BP13   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-34QPTRGKGKGKEKNKGKAPAEBasic
NLS Segment(s)
PositionSequence
17-31TRGKGKGKEKNKGKA
61-74RGKGKGKEKDKGKA
Subcellular Location(s) mito 17, nucl 6, cyto 3
Family & Domain DBs
Amino Acid Sequences EDSIEAPSSTSHKEQPTRGKGKGKEKNKGKAPAENAGGVWDIGNMRPSAEVATNHMEQPTRGKGKGKEKDKGKAPAENADGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.58
4 0.61
5 0.65
6 0.68
7 0.68
8 0.74
9 0.76
10 0.75
11 0.74
12 0.76
13 0.79
14 0.79
15 0.8
16 0.72
17 0.69
18 0.64
19 0.6
20 0.53
21 0.44
22 0.35
23 0.27
24 0.24
25 0.17
26 0.13
27 0.07
28 0.06
29 0.05
30 0.07
31 0.05
32 0.05
33 0.06
34 0.06
35 0.07
36 0.09
37 0.09
38 0.11
39 0.16
40 0.16
41 0.17
42 0.18
43 0.17
44 0.15
45 0.2
46 0.25
47 0.25
48 0.27
49 0.33
50 0.39
51 0.5
52 0.59
53 0.62
54 0.63
55 0.65
56 0.72
57 0.75
58 0.76
59 0.7
60 0.68
61 0.63
62 0.63