Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E5W2

Protein Details
Accession A0A0D0E5W2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-22AIWPRICRRRAVRTTARFNYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 4
Family & Domain DBs
Amino Acid Sequences MTAIWPRICRRRAVRTTARFNYLVFATFAILDPTLPPSTLDVMTKSAHVYRGAEVSNIMEEGLCGHNLCRPHGTLIGLDQTPLAFLFHCTGLSKSDCVMTLSINRHC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.81
4 0.78
5 0.74
6 0.64
7 0.56
8 0.49
9 0.39
10 0.31
11 0.21
12 0.16
13 0.12
14 0.11
15 0.11
16 0.09
17 0.08
18 0.07
19 0.07
20 0.1
21 0.1
22 0.09
23 0.09
24 0.1
25 0.12
26 0.13
27 0.13
28 0.11
29 0.13
30 0.13
31 0.13
32 0.13
33 0.12
34 0.12
35 0.12
36 0.12
37 0.11
38 0.13
39 0.12
40 0.11
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.04
47 0.04
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.08
54 0.09
55 0.11
56 0.12
57 0.12
58 0.14
59 0.16
60 0.17
61 0.15
62 0.16
63 0.18
64 0.16
65 0.15
66 0.13
67 0.11
68 0.1
69 0.1
70 0.09
71 0.05
72 0.06
73 0.08
74 0.09
75 0.1
76 0.11
77 0.12
78 0.15
79 0.17
80 0.17
81 0.16
82 0.17
83 0.17
84 0.18
85 0.17
86 0.16
87 0.21