Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DQK2

Protein Details
Accession A0A0D0DQK2   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
119-138RADRPIYRVRPKVRHRGDEFBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 8.833, mito 5.5, cyto_mito 4.333, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024047  MM3350-like_sf  
IPR012912  Plasmid_pRiA4b_Orf3  
Pfam View protein in Pfam  
PF07929  PRiA4_ORF3  
Amino Acid Sequences MPNSSASSSSASHGPDPYTILPQITTDYIQLRFQLARFGVHRIVRLPLTFTFANLHTLIQYMFGWSDSHLHQAEVFPNVVLHSDKKLPGFIKSCGRKRPIEDYELGDALAINHWERFERADRPIYRVRPKVRHRGDEFDRIMTMEDKVSHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.22
4 0.22
5 0.23
6 0.21
7 0.19
8 0.18
9 0.17
10 0.19
11 0.16
12 0.15
13 0.13
14 0.16
15 0.17
16 0.18
17 0.18
18 0.18
19 0.17
20 0.17
21 0.2
22 0.18
23 0.2
24 0.2
25 0.23
26 0.26
27 0.27
28 0.28
29 0.24
30 0.26
31 0.23
32 0.22
33 0.21
34 0.17
35 0.2
36 0.18
37 0.18
38 0.17
39 0.16
40 0.19
41 0.16
42 0.16
43 0.11
44 0.11
45 0.1
46 0.1
47 0.09
48 0.06
49 0.06
50 0.07
51 0.07
52 0.07
53 0.09
54 0.08
55 0.12
56 0.11
57 0.11
58 0.11
59 0.12
60 0.12
61 0.12
62 0.11
63 0.07
64 0.07
65 0.07
66 0.08
67 0.08
68 0.08
69 0.08
70 0.11
71 0.12
72 0.13
73 0.16
74 0.16
75 0.2
76 0.22
77 0.23
78 0.31
79 0.38
80 0.43
81 0.47
82 0.51
83 0.5
84 0.51
85 0.57
86 0.52
87 0.48
88 0.44
89 0.41
90 0.4
91 0.36
92 0.31
93 0.21
94 0.17
95 0.13
96 0.12
97 0.09
98 0.06
99 0.07
100 0.07
101 0.09
102 0.09
103 0.13
104 0.16
105 0.2
106 0.24
107 0.33
108 0.34
109 0.4
110 0.48
111 0.52
112 0.57
113 0.61
114 0.66
115 0.67
116 0.74
117 0.79
118 0.8
119 0.82
120 0.78
121 0.79
122 0.76
123 0.76
124 0.7
125 0.62
126 0.53
127 0.43
128 0.4
129 0.31
130 0.26
131 0.19