Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0E1H5

Protein Details
Accession A0A0D0E1H5   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MQRKLVEHSKRRRTRAREQPTKRHDLFBasic
NLS Segment(s)
PositionSequence
10-17KRRRTRAR
Subcellular Location(s) nucl 14.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MQRKLVEHSKRRRTRAREQPTKRHDLFYASVEVQECKKPPSRTVKIFIRRQSVASPTPPTRARDWPCQLTRDLSRCTISSELKRAASLERRASLTEGNVKGGWRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.86
3 0.86
4 0.86
5 0.87
6 0.89
7 0.87
8 0.88
9 0.79
10 0.71
11 0.61
12 0.55
13 0.47
14 0.39
15 0.35
16 0.26
17 0.25
18 0.22
19 0.22
20 0.19
21 0.2
22 0.18
23 0.17
24 0.25
25 0.25
26 0.32
27 0.41
28 0.47
29 0.49
30 0.55
31 0.61
32 0.63
33 0.68
34 0.66
35 0.61
36 0.54
37 0.51
38 0.45
39 0.39
40 0.33
41 0.29
42 0.28
43 0.24
44 0.28
45 0.3
46 0.3
47 0.3
48 0.37
49 0.39
50 0.44
51 0.48
52 0.51
53 0.51
54 0.51
55 0.48
56 0.44
57 0.45
58 0.41
59 0.38
60 0.32
61 0.31
62 0.3
63 0.32
64 0.31
65 0.31
66 0.3
67 0.34
68 0.35
69 0.34
70 0.34
71 0.32
72 0.34
73 0.37
74 0.39
75 0.39
76 0.38
77 0.39
78 0.4
79 0.41
80 0.37
81 0.33
82 0.35
83 0.3
84 0.3
85 0.3