Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HKJ4

Protein Details
Accession C6HKJ4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
28-50LHFVRAARPRQGPRLKRRCTDNAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, extr 8, cyto_mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR027539  Mdm10  
Gene Ontology GO:0032865  C:ERMES complex  
GO:0007005  P:mitochondrion organization  
Pfam View protein in Pfam  
PF12519  MDM10  
Amino Acid Sequences MRHYISRLQLRSQGYFSVVYLLPPNSLLHFVRAARPRQGPRLKRRCTDNALFGFKGLWNFGPDPRKQNQQGDLARDSRRSLLSLLSAGAEAYYSPVSSVVGLSTGLRFTTLPAATGSPHFTFPYTLTLTLTPLTGSMSTTYSLLASPNVSFSSRFGFNVYSWESEMVAGCELWRRSSNNRLHDDKSQRDSALFGVDDLTWARRKMGLPDTAPSRNRECDDLPPPRYDNYYHQRSPHASDSVIKVRVDQSWNIRALWEGRVKELLVSAGVALGPTPRSSLSYASSSAAGGVGAAGGLSSYGWKSVGVSVLYSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.28
4 0.26
5 0.21
6 0.19
7 0.2
8 0.19
9 0.17
10 0.18
11 0.18
12 0.15
13 0.19
14 0.18
15 0.18
16 0.21
17 0.22
18 0.29
19 0.35
20 0.38
21 0.41
22 0.49
23 0.52
24 0.59
25 0.68
26 0.7
27 0.74
28 0.81
29 0.81
30 0.79
31 0.82
32 0.8
33 0.78
34 0.75
35 0.72
36 0.69
37 0.67
38 0.6
39 0.52
40 0.44
41 0.37
42 0.32
43 0.24
44 0.18
45 0.16
46 0.17
47 0.23
48 0.29
49 0.31
50 0.36
51 0.38
52 0.46
53 0.48
54 0.53
55 0.53
56 0.56
57 0.57
58 0.56
59 0.57
60 0.53
61 0.49
62 0.45
63 0.4
64 0.34
65 0.3
66 0.26
67 0.22
68 0.18
69 0.17
70 0.16
71 0.15
72 0.12
73 0.11
74 0.09
75 0.08
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.04
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.12
97 0.12
98 0.12
99 0.12
100 0.13
101 0.13
102 0.15
103 0.17
104 0.13
105 0.14
106 0.13
107 0.13
108 0.13
109 0.14
110 0.17
111 0.15
112 0.14
113 0.14
114 0.14
115 0.15
116 0.14
117 0.13
118 0.08
119 0.07
120 0.07
121 0.06
122 0.06
123 0.06
124 0.07
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.07
135 0.07
136 0.08
137 0.08
138 0.08
139 0.11
140 0.11
141 0.11
142 0.11
143 0.12
144 0.12
145 0.15
146 0.16
147 0.13
148 0.13
149 0.13
150 0.12
151 0.11
152 0.11
153 0.08
154 0.06
155 0.05
156 0.05
157 0.08
158 0.08
159 0.1
160 0.12
161 0.14
162 0.18
163 0.28
164 0.34
165 0.39
166 0.45
167 0.48
168 0.49
169 0.54
170 0.58
171 0.54
172 0.52
173 0.46
174 0.41
175 0.36
176 0.34
177 0.27
178 0.22
179 0.15
180 0.11
181 0.09
182 0.09
183 0.09
184 0.09
185 0.11
186 0.1
187 0.1
188 0.11
189 0.13
190 0.14
191 0.19
192 0.25
193 0.29
194 0.28
195 0.32
196 0.37
197 0.41
198 0.42
199 0.4
200 0.38
201 0.36
202 0.36
203 0.36
204 0.32
205 0.33
206 0.39
207 0.44
208 0.43
209 0.43
210 0.43
211 0.4
212 0.41
213 0.37
214 0.38
215 0.38
216 0.44
217 0.43
218 0.44
219 0.48
220 0.49
221 0.51
222 0.48
223 0.41
224 0.33
225 0.33
226 0.37
227 0.38
228 0.39
229 0.33
230 0.29
231 0.28
232 0.32
233 0.33
234 0.31
235 0.31
236 0.34
237 0.36
238 0.34
239 0.32
240 0.29
241 0.28
242 0.3
243 0.3
244 0.24
245 0.25
246 0.26
247 0.26
248 0.25
249 0.24
250 0.18
251 0.12
252 0.11
253 0.09
254 0.07
255 0.07
256 0.06
257 0.05
258 0.06
259 0.07
260 0.07
261 0.09
262 0.09
263 0.11
264 0.13
265 0.16
266 0.18
267 0.21
268 0.22
269 0.22
270 0.22
271 0.19
272 0.18
273 0.15
274 0.11
275 0.08
276 0.06
277 0.04
278 0.03
279 0.03
280 0.03
281 0.02
282 0.03
283 0.03
284 0.04
285 0.05
286 0.06
287 0.07
288 0.07
289 0.09
290 0.11
291 0.16
292 0.15