Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DH79

Protein Details
Accession A0A0D0DH79   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
168-202SYLPLRTEKKRQRGNVGSRRRDKSHKCPRPGCTKSHydrophilic
NLS Segment(s)
PositionSequence
176-190KKRQRGNVGSRRRDK
Subcellular Location(s) cyto_nucl 12.833, nucl 11.5, cyto 11, cyto_mito 6.999
Family & Domain DBs
Amino Acid Sequences MSPSLGMHVPLPSSSPCNGMSWNGDHIPTLERDFCSNFTCCGRSLGDLHELIDHFEEAHVIVIGPDGSSIYPVSQTGLSDRTPTPYCAAAPFSKVVFEDHRSWISEAVSDPFRIIPAKLAVPETAALVADFDVISEKWTNLSADQLCLPPSSFTADTDVDAERDGHSSYLPLRTEKKRQRGNVGSRRRDKSHKCPRPGCTKSYLNPNGLKYHLEKGTCSIDPTFHRDPLRANCKDPFLVPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.2
4 0.21
5 0.22
6 0.22
7 0.24
8 0.23
9 0.27
10 0.25
11 0.24
12 0.23
13 0.23
14 0.23
15 0.21
16 0.22
17 0.2
18 0.2
19 0.22
20 0.24
21 0.25
22 0.26
23 0.25
24 0.24
25 0.24
26 0.25
27 0.23
28 0.24
29 0.23
30 0.22
31 0.22
32 0.22
33 0.24
34 0.22
35 0.22
36 0.22
37 0.2
38 0.19
39 0.18
40 0.15
41 0.1
42 0.09
43 0.09
44 0.06
45 0.07
46 0.06
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.06
59 0.06
60 0.07
61 0.07
62 0.08
63 0.09
64 0.11
65 0.11
66 0.14
67 0.14
68 0.18
69 0.19
70 0.2
71 0.2
72 0.19
73 0.19
74 0.17
75 0.2
76 0.16
77 0.17
78 0.17
79 0.15
80 0.14
81 0.14
82 0.15
83 0.15
84 0.18
85 0.19
86 0.2
87 0.22
88 0.22
89 0.23
90 0.21
91 0.18
92 0.16
93 0.13
94 0.13
95 0.12
96 0.11
97 0.1
98 0.09
99 0.1
100 0.09
101 0.09
102 0.08
103 0.09
104 0.09
105 0.1
106 0.11
107 0.1
108 0.1
109 0.1
110 0.08
111 0.07
112 0.06
113 0.05
114 0.04
115 0.04
116 0.04
117 0.03
118 0.03
119 0.04
120 0.04
121 0.05
122 0.06
123 0.06
124 0.06
125 0.07
126 0.08
127 0.07
128 0.12
129 0.11
130 0.11
131 0.13
132 0.13
133 0.13
134 0.13
135 0.13
136 0.09
137 0.09
138 0.12
139 0.12
140 0.11
141 0.15
142 0.15
143 0.15
144 0.16
145 0.16
146 0.11
147 0.12
148 0.12
149 0.08
150 0.09
151 0.09
152 0.08
153 0.07
154 0.08
155 0.1
156 0.14
157 0.15
158 0.17
159 0.24
160 0.3
161 0.41
162 0.49
163 0.57
164 0.61
165 0.65
166 0.72
167 0.75
168 0.8
169 0.8
170 0.82
171 0.82
172 0.82
173 0.83
174 0.78
175 0.78
176 0.76
177 0.77
178 0.78
179 0.78
180 0.79
181 0.81
182 0.82
183 0.84
184 0.8
185 0.73
186 0.7
187 0.67
188 0.62
189 0.65
190 0.63
191 0.59
192 0.59
193 0.57
194 0.53
195 0.47
196 0.45
197 0.38
198 0.39
199 0.37
200 0.33
201 0.31
202 0.31
203 0.35
204 0.33
205 0.32
206 0.26
207 0.27
208 0.3
209 0.37
210 0.37
211 0.37
212 0.38
213 0.38
214 0.44
215 0.49
216 0.56
217 0.52
218 0.52
219 0.51
220 0.54
221 0.54