Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HCK9

Protein Details
Accession C6HCK9   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-27QTTPRKITPRFTRARQERKMANPNEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto_nucl 9, nucl 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004023  Mago_nashi  
IPR036605  Mago_nashi_sf  
Gene Ontology GO:0035145  C:exon-exon junction complex  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF02792  Mago_nashi  
Amino Acid Sequences MNQTTPRKITPRFTRARQERKMANPNEPFYVRYYSGHSGRFGHEFLEFDFRSLGDGRSASARYANNSNYRNDSLIRKERSLVDVTESADPEGLRVFYYLVQDLKALVFSLISLHFKASETQKFSLPRNTLSNPEASAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.85
4 0.82
5 0.8
6 0.77
7 0.78
8 0.81
9 0.74
10 0.73
11 0.7
12 0.65
13 0.61
14 0.55
15 0.46
16 0.39
17 0.4
18 0.32
19 0.26
20 0.29
21 0.29
22 0.32
23 0.33
24 0.31
25 0.28
26 0.29
27 0.3
28 0.25
29 0.2
30 0.17
31 0.15
32 0.15
33 0.2
34 0.18
35 0.16
36 0.16
37 0.15
38 0.16
39 0.16
40 0.15
41 0.09
42 0.09
43 0.09
44 0.11
45 0.12
46 0.1
47 0.13
48 0.13
49 0.14
50 0.18
51 0.21
52 0.25
53 0.26
54 0.28
55 0.27
56 0.28
57 0.27
58 0.25
59 0.25
60 0.26
61 0.32
62 0.33
63 0.3
64 0.31
65 0.31
66 0.33
67 0.31
68 0.24
69 0.19
70 0.18
71 0.19
72 0.19
73 0.18
74 0.15
75 0.14
76 0.13
77 0.1
78 0.09
79 0.08
80 0.06
81 0.06
82 0.07
83 0.07
84 0.09
85 0.11
86 0.11
87 0.11
88 0.11
89 0.11
90 0.11
91 0.09
92 0.08
93 0.06
94 0.05
95 0.05
96 0.07
97 0.08
98 0.1
99 0.1
100 0.1
101 0.11
102 0.12
103 0.17
104 0.22
105 0.27
106 0.31
107 0.32
108 0.37
109 0.41
110 0.44
111 0.49
112 0.45
113 0.43
114 0.45
115 0.47
116 0.47
117 0.45
118 0.44