Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HC22

Protein Details
Accession C6HC22    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
43-68EQDYERRPRKTSKRDKEKNRLPIKTABasic
NLS Segment(s)
PositionSequence
48-62RRPRKTSKRDKEKNR
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011501  Noc3_N  
IPR016903  Nucleolar_cplx-assoc_3  
Pfam View protein in Pfam  
PF07540  NOC3p  
Amino Acid Sequences MATEHAFKRKRLSLSKDGDSYTPSTNGSSMKDFYSRAAEWNLEQDYERRPRKTSKRDKEKNRLPIKTAEGTIEHVSEPIVEDDSEDLFDSDEDDVEEQPEAEVVEKPKPHVPAKVQILKAKEELARIAELINEDPEEHTGLFKRLADMVSETSLPAVKKLALATQVAIYRDVIPGYRIRPLGEDDMATNVSKDVRKLRNFEQSLLAGYQNTVKVLASVARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.68
4 0.63
5 0.55
6 0.49
7 0.43
8 0.36
9 0.29
10 0.23
11 0.21
12 0.21
13 0.22
14 0.22
15 0.22
16 0.21
17 0.21
18 0.23
19 0.22
20 0.23
21 0.27
22 0.24
23 0.23
24 0.25
25 0.24
26 0.22
27 0.27
28 0.26
29 0.2
30 0.2
31 0.2
32 0.24
33 0.33
34 0.39
35 0.36
36 0.39
37 0.48
38 0.58
39 0.68
40 0.72
41 0.73
42 0.78
43 0.86
44 0.93
45 0.94
46 0.92
47 0.92
48 0.9
49 0.83
50 0.75
51 0.71
52 0.65
53 0.57
54 0.49
55 0.4
56 0.31
57 0.3
58 0.28
59 0.22
60 0.17
61 0.13
62 0.12
63 0.1
64 0.1
65 0.07
66 0.07
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.06
73 0.06
74 0.05
75 0.05
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.06
84 0.05
85 0.04
86 0.04
87 0.04
88 0.05
89 0.06
90 0.08
91 0.11
92 0.12
93 0.14
94 0.17
95 0.21
96 0.22
97 0.25
98 0.26
99 0.31
100 0.37
101 0.42
102 0.41
103 0.4
104 0.41
105 0.38
106 0.35
107 0.3
108 0.25
109 0.19
110 0.17
111 0.15
112 0.14
113 0.12
114 0.11
115 0.09
116 0.08
117 0.08
118 0.08
119 0.06
120 0.06
121 0.07
122 0.07
123 0.08
124 0.07
125 0.08
126 0.08
127 0.1
128 0.11
129 0.11
130 0.11
131 0.11
132 0.12
133 0.12
134 0.12
135 0.13
136 0.13
137 0.12
138 0.11
139 0.1
140 0.12
141 0.11
142 0.1
143 0.09
144 0.09
145 0.1
146 0.11
147 0.13
148 0.13
149 0.13
150 0.13
151 0.16
152 0.18
153 0.17
154 0.17
155 0.16
156 0.15
157 0.15
158 0.14
159 0.12
160 0.11
161 0.14
162 0.15
163 0.19
164 0.19
165 0.19
166 0.2
167 0.24
168 0.26
169 0.24
170 0.23
171 0.18
172 0.21
173 0.21
174 0.19
175 0.15
176 0.12
177 0.15
178 0.15
179 0.18
180 0.25
181 0.33
182 0.39
183 0.45
184 0.51
185 0.58
186 0.59
187 0.58
188 0.54
189 0.46
190 0.44
191 0.4
192 0.33
193 0.23
194 0.21
195 0.23
196 0.18
197 0.17
198 0.15
199 0.13
200 0.12
201 0.14