Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6H9Q5

Protein Details
Accession C6H9Q5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-84LEKLRTLREKLKQQRQHLDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007648  ATPase_inhibitor_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0042030  F:ATPase inhibitor activity  
GO:0032780  P:negative regulation of ATP-dependent activity  
Pfam View protein in Pfam  
PF04568  IATP  
Amino Acid Sequences MLRQTARPLLRASQPRLNRLFSVAAARMGEGDVGAPKSTGKLSTTNSWSKKEAADEAMYIKQRELEKLRTLREKLKQQRQHLDELDAHIEQLTREHGGEQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.58
3 0.59
4 0.58
5 0.5
6 0.45
7 0.4
8 0.32
9 0.32
10 0.25
11 0.23
12 0.2
13 0.19
14 0.15
15 0.14
16 0.12
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.07
25 0.08
26 0.09
27 0.09
28 0.12
29 0.15
30 0.2
31 0.25
32 0.31
33 0.34
34 0.36
35 0.35
36 0.33
37 0.31
38 0.27
39 0.24
40 0.19
41 0.17
42 0.14
43 0.15
44 0.17
45 0.18
46 0.16
47 0.15
48 0.17
49 0.17
50 0.21
51 0.23
52 0.25
53 0.32
54 0.36
55 0.42
56 0.45
57 0.48
58 0.5
59 0.54
60 0.6
61 0.62
62 0.69
63 0.72
64 0.73
65 0.8
66 0.76
67 0.76
68 0.68
69 0.62
70 0.53
71 0.48
72 0.43
73 0.32
74 0.29
75 0.21
76 0.19
77 0.15
78 0.14
79 0.13
80 0.11
81 0.12