Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D8U1

Protein Details
Accession A0A0D0D8U1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23KPRDKPTQYNWPAKKQKNTQDVPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.499, cyto_nucl 10.333, mito 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences KPRDKPTQYNWPAKKQKNTQDVPSTSAQPAQSITQSNLTLSDWITVFAYIDSHPTVPQNSVVKHFGTLKSGTLIFTQATLSRKLHTQPVLEAHVNDNLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.82
4 0.81
5 0.79
6 0.77
7 0.76
8 0.69
9 0.64
10 0.57
11 0.5
12 0.4
13 0.38
14 0.3
15 0.21
16 0.21
17 0.18
18 0.17
19 0.16
20 0.17
21 0.17
22 0.17
23 0.16
24 0.16
25 0.15
26 0.13
27 0.11
28 0.11
29 0.08
30 0.08
31 0.08
32 0.07
33 0.07
34 0.06
35 0.06
36 0.05
37 0.06
38 0.06
39 0.07
40 0.07
41 0.08
42 0.09
43 0.09
44 0.13
45 0.15
46 0.16
47 0.19
48 0.21
49 0.2
50 0.21
51 0.23
52 0.2
53 0.2
54 0.2
55 0.17
56 0.17
57 0.17
58 0.16
59 0.14
60 0.14
61 0.11
62 0.11
63 0.11
64 0.13
65 0.14
66 0.17
67 0.18
68 0.18
69 0.21
70 0.24
71 0.3
72 0.31
73 0.31
74 0.31
75 0.36
76 0.41
77 0.39
78 0.38
79 0.33