Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DBY4

Protein Details
Accession A0A0D0DBY4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-98ELGKNLWRGSRKKRRRILSGFQTGCHydrophilic
NLS Segment(s)
PositionSequence
81-89RGSRKKRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MPHSQPRKRPRNISGFHDDLDQHDSESDEEFENTVVVAFDGLKINFEEAYGDNNDSDLSDINEEFEFGILEDEELGKNLWRGSRKKRRRILSGFQTGCKEKGSSMQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.68
3 0.6
4 0.53
5 0.44
6 0.35
7 0.34
8 0.26
9 0.18
10 0.15
11 0.15
12 0.13
13 0.14
14 0.13
15 0.1
16 0.1
17 0.1
18 0.1
19 0.09
20 0.08
21 0.06
22 0.05
23 0.04
24 0.04
25 0.04
26 0.05
27 0.07
28 0.07
29 0.07
30 0.07
31 0.08
32 0.08
33 0.07
34 0.08
35 0.06
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.07
43 0.07
44 0.05
45 0.05
46 0.05
47 0.05
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.07
65 0.09
66 0.13
67 0.19
68 0.27
69 0.37
70 0.49
71 0.59
72 0.68
73 0.76
74 0.81
75 0.84
76 0.86
77 0.85
78 0.85
79 0.85
80 0.78
81 0.73
82 0.7
83 0.63
84 0.55
85 0.47
86 0.37