Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D6S0

Protein Details
Accession A0A0D0D6S0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-35HSQKHPSHTKNHSSQKKRQSKVERIRNALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences SSHSMDHSQKHPSHTKNHSSQKKRQSKVERIRNALAIVHDGKISFIDFLSQILDPSEKEFKAYCMAIYSVDGNSPPKLYQLFDLILNDPYGGLLFHRWIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.67
4 0.75
5 0.78
6 0.77
7 0.82
8 0.83
9 0.85
10 0.8
11 0.8
12 0.8
13 0.8
14 0.83
15 0.84
16 0.81
17 0.77
18 0.74
19 0.66
20 0.56
21 0.46
22 0.36
23 0.29
24 0.22
25 0.16
26 0.14
27 0.12
28 0.11
29 0.1
30 0.1
31 0.06
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.06
42 0.09
43 0.12
44 0.11
45 0.12
46 0.12
47 0.13
48 0.16
49 0.16
50 0.13
51 0.12
52 0.13
53 0.12
54 0.12
55 0.12
56 0.09
57 0.09
58 0.1
59 0.1
60 0.11
61 0.12
62 0.11
63 0.12
64 0.13
65 0.14
66 0.15
67 0.17
68 0.18
69 0.18
70 0.2
71 0.19
72 0.19
73 0.18
74 0.16
75 0.12
76 0.11
77 0.09
78 0.07
79 0.07
80 0.08