Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0C9J4

Protein Details
Accession A0A0D0C9J4   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-60NSYSGPVERKKQAKKGKKAKVNAVSMHydrophilic
270-291KDSGVQQARKKVRERKSDGKDGBasic
NLS Segment(s)
PositionSequence
43-54RKKQAKKGKKAK
191-192GK
279-285KKVRERK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
Amino Acid Sequences MGGWGAHQRWMEYAKKALGDSASDEEESLTNTNSNSYSGPVERKKQAKKGKKAKVNAVSMVSHIGKAWIGDVKDASLDVMKHMVRGFITFHYRQASGVKDGSVPWMQISTQRYDYISGKYLSQGAKLQEPSKLQKKEVISLLEFWRDRQKLDLANIFTFRKWRDATGTLQDPVEVDSDEEGAPQRRTAAKGKRKAEPYHWMTNTEESKDDQGGLTDQGEPSDVSQEPGAGSKHLDMGKQARGRGLDNEGSEEEETNGRRQTQSEVVCNPKDSGVQQARKKVRERKSDGKDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.33
4 0.33
5 0.29
6 0.26
7 0.26
8 0.24
9 0.22
10 0.2
11 0.2
12 0.18
13 0.17
14 0.18
15 0.15
16 0.12
17 0.11
18 0.11
19 0.13
20 0.13
21 0.14
22 0.13
23 0.14
24 0.16
25 0.19
26 0.28
27 0.32
28 0.38
29 0.45
30 0.53
31 0.6
32 0.66
33 0.73
34 0.75
35 0.8
36 0.84
37 0.87
38 0.87
39 0.87
40 0.87
41 0.85
42 0.8
43 0.73
44 0.65
45 0.55
46 0.46
47 0.43
48 0.33
49 0.24
50 0.19
51 0.15
52 0.12
53 0.11
54 0.12
55 0.11
56 0.1
57 0.11
58 0.12
59 0.11
60 0.11
61 0.11
62 0.1
63 0.09
64 0.08
65 0.08
66 0.12
67 0.12
68 0.13
69 0.13
70 0.14
71 0.12
72 0.13
73 0.14
74 0.13
75 0.2
76 0.19
77 0.21
78 0.23
79 0.23
80 0.23
81 0.24
82 0.23
83 0.2
84 0.2
85 0.18
86 0.16
87 0.16
88 0.19
89 0.17
90 0.14
91 0.11
92 0.11
93 0.1
94 0.14
95 0.17
96 0.16
97 0.17
98 0.18
99 0.19
100 0.21
101 0.23
102 0.21
103 0.21
104 0.18
105 0.17
106 0.17
107 0.2
108 0.17
109 0.17
110 0.18
111 0.16
112 0.19
113 0.21
114 0.21
115 0.21
116 0.24
117 0.28
118 0.34
119 0.35
120 0.32
121 0.35
122 0.36
123 0.36
124 0.36
125 0.33
126 0.24
127 0.25
128 0.26
129 0.26
130 0.24
131 0.21
132 0.25
133 0.23
134 0.23
135 0.22
136 0.23
137 0.21
138 0.24
139 0.28
140 0.22
141 0.23
142 0.25
143 0.24
144 0.21
145 0.21
146 0.19
147 0.2
148 0.18
149 0.18
150 0.2
151 0.23
152 0.26
153 0.29
154 0.31
155 0.26
156 0.25
157 0.24
158 0.19
159 0.18
160 0.15
161 0.09
162 0.06
163 0.06
164 0.07
165 0.07
166 0.07
167 0.08
168 0.1
169 0.1
170 0.1
171 0.13
172 0.14
173 0.17
174 0.26
175 0.35
176 0.41
177 0.5
178 0.54
179 0.59
180 0.64
181 0.65
182 0.63
183 0.63
184 0.6
185 0.61
186 0.58
187 0.53
188 0.47
189 0.5
190 0.46
191 0.38
192 0.32
193 0.24
194 0.25
195 0.23
196 0.22
197 0.14
198 0.13
199 0.12
200 0.12
201 0.11
202 0.1
203 0.1
204 0.09
205 0.1
206 0.09
207 0.09
208 0.11
209 0.11
210 0.1
211 0.11
212 0.11
213 0.1
214 0.13
215 0.13
216 0.1
217 0.11
218 0.11
219 0.16
220 0.17
221 0.17
222 0.19
223 0.23
224 0.3
225 0.33
226 0.33
227 0.31
228 0.32
229 0.34
230 0.33
231 0.34
232 0.3
233 0.28
234 0.3
235 0.27
236 0.28
237 0.26
238 0.23
239 0.19
240 0.19
241 0.2
242 0.2
243 0.22
244 0.22
245 0.22
246 0.23
247 0.27
248 0.32
249 0.35
250 0.38
251 0.42
252 0.47
253 0.49
254 0.5
255 0.45
256 0.38
257 0.36
258 0.3
259 0.34
260 0.37
261 0.43
262 0.47
263 0.56
264 0.63
265 0.68
266 0.77
267 0.76
268 0.76
269 0.78
270 0.81
271 0.82