Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DKZ4

Protein Details
Accession A0A0D0DKZ4    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
85-111APKVNPPCRKRTHRTTNKWTRCQKLTCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, mito_nucl 13.666, cyto_nucl 12.333
Family & Domain DBs
Amino Acid Sequences MDPSPQERLYCLKSGPCHLKLDPTSRKWTRHLKSDPIVSKVDLPCRKRTHRVANGPIISKANPLPHKNRPIALKMDCYLKSDPTAPKVNPPCRKRTHRTTNKWTRCQKLTCRLKMNPTISRCCNGEPVASDPIASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.45
4 0.46
5 0.43
6 0.49
7 0.49
8 0.55
9 0.56
10 0.52
11 0.59
12 0.6
13 0.63
14 0.62
15 0.68
16 0.63
17 0.65
18 0.66
19 0.64
20 0.64
21 0.69
22 0.65
23 0.58
24 0.55
25 0.45
26 0.44
27 0.38
28 0.42
29 0.4
30 0.39
31 0.44
32 0.5
33 0.55
34 0.57
35 0.63
36 0.65
37 0.68
38 0.73
39 0.71
40 0.72
41 0.69
42 0.62
43 0.55
44 0.45
45 0.36
46 0.28
47 0.23
48 0.22
49 0.23
50 0.26
51 0.31
52 0.37
53 0.43
54 0.43
55 0.44
56 0.41
57 0.39
58 0.41
59 0.36
60 0.32
61 0.27
62 0.3
63 0.28
64 0.28
65 0.26
66 0.21
67 0.21
68 0.23
69 0.24
70 0.23
71 0.28
72 0.25
73 0.33
74 0.41
75 0.49
76 0.54
77 0.56
78 0.6
79 0.64
80 0.73
81 0.72
82 0.74
83 0.76
84 0.78
85 0.84
86 0.86
87 0.88
88 0.9
89 0.91
90 0.89
91 0.85
92 0.81
93 0.79
94 0.77
95 0.77
96 0.77
97 0.76
98 0.77
99 0.74
100 0.75
101 0.76
102 0.74
103 0.71
104 0.67
105 0.66
106 0.61
107 0.61
108 0.55
109 0.48
110 0.45
111 0.39
112 0.36
113 0.31
114 0.32
115 0.32
116 0.29