Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0D5V4

Protein Details
Accession A0A0D0D5V4   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
144-169TGPGDVRHGRGKRRKVANKQYGNFDEHydrophilic
NLS Segment(s)
PositionSequence
152-158GRGKRRK
Subcellular Location(s) cyto 16.5, cyto_nucl 12, nucl 4.5, mito 2, extr 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
Amino Acid Sequences AFLLCKAGPNDQFNLSFERLSSPETLWALRTLPKDEQKLWKKLTGDVFGKGEDAAVPSQATCSAGDVGEDGGNIEPPFSATDLENAELTNDDAPLDVVMEHLANDNSSKKLPVGYTITTDGSIVITTELELYERVVMEAATDETGPGDVRHGRGKRRKVANKQYGNFDEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.32
3 0.27
4 0.23
5 0.24
6 0.21
7 0.22
8 0.23
9 0.17
10 0.2
11 0.22
12 0.22
13 0.19
14 0.19
15 0.18
16 0.22
17 0.23
18 0.23
19 0.29
20 0.35
21 0.38
22 0.42
23 0.51
24 0.54
25 0.6
26 0.59
27 0.57
28 0.51
29 0.52
30 0.53
31 0.5
32 0.44
33 0.39
34 0.36
35 0.32
36 0.3
37 0.25
38 0.18
39 0.11
40 0.11
41 0.08
42 0.07
43 0.07
44 0.06
45 0.07
46 0.07
47 0.08
48 0.06
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.07
55 0.06
56 0.06
57 0.05
58 0.05
59 0.06
60 0.06
61 0.05
62 0.04
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.08
69 0.08
70 0.09
71 0.08
72 0.08
73 0.07
74 0.07
75 0.07
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.04
83 0.03
84 0.03
85 0.04
86 0.04
87 0.04
88 0.05
89 0.05
90 0.05
91 0.06
92 0.08
93 0.09
94 0.09
95 0.1
96 0.09
97 0.12
98 0.12
99 0.15
100 0.18
101 0.18
102 0.2
103 0.22
104 0.22
105 0.2
106 0.19
107 0.15
108 0.11
109 0.1
110 0.07
111 0.05
112 0.05
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.06
119 0.07
120 0.07
121 0.07
122 0.07
123 0.06
124 0.06
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.08
132 0.08
133 0.07
134 0.1
135 0.12
136 0.15
137 0.24
138 0.29
139 0.39
140 0.48
141 0.57
142 0.64
143 0.72
144 0.8
145 0.82
146 0.89
147 0.89
148 0.9
149 0.85
150 0.85