Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0DRZ4

Protein Details
Accession A0A0D0DRZ4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
64-88GMMHGKRQHECKRPYRTDKKSRRRTBasic
NLS Segment(s)
PositionSequence
81-87DKKSRRR
Subcellular Location(s) extr 16, mito 6, E.R. 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MRLATSAIVASLAVLAVGASNPRPNYDLHARGQSESCGFKGDTCDPLKSPSCCPHLVCRAENNGMMHGKRQHECKRPYRTDKKSRRRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.04
6 0.05
7 0.09
8 0.09
9 0.11
10 0.12
11 0.13
12 0.19
13 0.26
14 0.3
15 0.29
16 0.35
17 0.35
18 0.35
19 0.35
20 0.3
21 0.24
22 0.21
23 0.19
24 0.14
25 0.13
26 0.13
27 0.16
28 0.16
29 0.19
30 0.2
31 0.21
32 0.19
33 0.23
34 0.26
35 0.24
36 0.27
37 0.27
38 0.3
39 0.31
40 0.32
41 0.35
42 0.4
43 0.42
44 0.4
45 0.38
46 0.39
47 0.39
48 0.4
49 0.34
50 0.3
51 0.29
52 0.27
53 0.27
54 0.28
55 0.32
56 0.32
57 0.41
58 0.46
59 0.53
60 0.62
61 0.67
62 0.72
63 0.77
64 0.85
65 0.86
66 0.88
67 0.89
68 0.92