Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D0CQ09

Protein Details
Accession A0A0D0CQ09    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
240-268RLLKWVFQNKARRCRRRRRALTMKELVRFHydrophilic
NLS Segment(s)
PositionSequence
254-257RRRR
Subcellular Location(s) nucl 12, cyto 9.5, cyto_mito 7, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
IPR025662  Sigma_54_int_dom_ATP-bd_1  
Gene Ontology GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
PROSITE View protein in PROSITE  
PS00675  SIGMA54_INTERACT_1  
Amino Acid Sequences MTPGNVITDRICPPSYEHQRRYSPNVIIFGETGAGKSSVVNLIAGEDLANVSSGAAGCTLDSASYDLVLSDAQDRSHHIRVFDTVGLNEATFTQDDYLKAIEKANELIFELQRTGGIRLLIFCIRSGRITSATQNNYRLFYEILCQNEVPVAFVITGLENERSMEDWWTKNAPEFERYQLHCTSHACVTATRGLHNLHAQKYEQSRNIVRAMLLQQTSNGEGSSWKPAEQTGWLIHTAGRLLKWVFQNKARRCRRRRRALTMKELVRFLENSFSLSPSDAEGLASKIWEMRQDSAGPDFVKREVDRNN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.47
3 0.53
4 0.57
5 0.61
6 0.69
7 0.74
8 0.76
9 0.73
10 0.68
11 0.63
12 0.61
13 0.53
14 0.47
15 0.41
16 0.33
17 0.27
18 0.2
19 0.15
20 0.12
21 0.11
22 0.09
23 0.09
24 0.1
25 0.11
26 0.11
27 0.11
28 0.09
29 0.1
30 0.1
31 0.1
32 0.08
33 0.06
34 0.05
35 0.05
36 0.06
37 0.05
38 0.04
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.06
56 0.06
57 0.08
58 0.09
59 0.09
60 0.1
61 0.15
62 0.2
63 0.27
64 0.28
65 0.25
66 0.26
67 0.28
68 0.3
69 0.28
70 0.23
71 0.17
72 0.17
73 0.16
74 0.15
75 0.13
76 0.1
77 0.09
78 0.08
79 0.08
80 0.07
81 0.09
82 0.09
83 0.1
84 0.11
85 0.11
86 0.12
87 0.13
88 0.13
89 0.13
90 0.15
91 0.14
92 0.13
93 0.13
94 0.14
95 0.13
96 0.12
97 0.12
98 0.09
99 0.1
100 0.11
101 0.11
102 0.1
103 0.1
104 0.1
105 0.1
106 0.12
107 0.12
108 0.11
109 0.11
110 0.11
111 0.11
112 0.12
113 0.12
114 0.12
115 0.14
116 0.15
117 0.19
118 0.25
119 0.28
120 0.3
121 0.34
122 0.33
123 0.32
124 0.31
125 0.28
126 0.2
127 0.16
128 0.17
129 0.15
130 0.15
131 0.15
132 0.14
133 0.13
134 0.14
135 0.13
136 0.11
137 0.08
138 0.06
139 0.05
140 0.05
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.06
149 0.07
150 0.07
151 0.09
152 0.11
153 0.11
154 0.13
155 0.14
156 0.14
157 0.16
158 0.19
159 0.19
160 0.19
161 0.2
162 0.23
163 0.28
164 0.29
165 0.31
166 0.29
167 0.29
168 0.28
169 0.28
170 0.26
171 0.21
172 0.2
173 0.17
174 0.15
175 0.16
176 0.19
177 0.18
178 0.16
179 0.17
180 0.16
181 0.18
182 0.23
183 0.25
184 0.23
185 0.24
186 0.24
187 0.27
188 0.32
189 0.36
190 0.34
191 0.35
192 0.35
193 0.36
194 0.37
195 0.33
196 0.27
197 0.25
198 0.23
199 0.23
200 0.21
201 0.18
202 0.17
203 0.17
204 0.18
205 0.15
206 0.13
207 0.08
208 0.09
209 0.11
210 0.17
211 0.17
212 0.16
213 0.16
214 0.17
215 0.18
216 0.18
217 0.2
218 0.15
219 0.16
220 0.16
221 0.16
222 0.16
223 0.16
224 0.15
225 0.13
226 0.12
227 0.13
228 0.13
229 0.18
230 0.24
231 0.3
232 0.33
233 0.39
234 0.5
235 0.56
236 0.66
237 0.72
238 0.76
239 0.8
240 0.87
241 0.9
242 0.91
243 0.93
244 0.93
245 0.93
246 0.92
247 0.92
248 0.91
249 0.86
250 0.78
251 0.69
252 0.59
253 0.51
254 0.42
255 0.32
256 0.3
257 0.23
258 0.23
259 0.22
260 0.22
261 0.2
262 0.2
263 0.19
264 0.14
265 0.15
266 0.12
267 0.12
268 0.12
269 0.13
270 0.12
271 0.11
272 0.1
273 0.11
274 0.12
275 0.17
276 0.19
277 0.21
278 0.25
279 0.26
280 0.29
281 0.29
282 0.33
283 0.28
284 0.27
285 0.26
286 0.24
287 0.3
288 0.29