Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8AAQ7

Protein Details
Accession A0A1S8AAQ7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
93-112RFPGAKRKERGDKGAHRPSPBasic
NLS Segment(s)
PositionSequence
92-112DRFPGAKRKERGDKGAHRPSP
Subcellular Location(s) plas 16, vacu 6, pero 2, mito 1, cyto 1, extr 1, cyto_mito 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MIILHLLGALVLGTPIVLPDHPALPRGSVIMREGPISADEGQNTTTVENGAQDPSEPAPDPVFTTVTIVGLVIGIFLILGAVVLLIWCGRRDRFPGAKRKERGDKGAHRPSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.04
4 0.04
5 0.07
6 0.08
7 0.12
8 0.12
9 0.15
10 0.15
11 0.15
12 0.15
13 0.15
14 0.14
15 0.12
16 0.14
17 0.15
18 0.15
19 0.15
20 0.14
21 0.13
22 0.13
23 0.14
24 0.13
25 0.1
26 0.1
27 0.1
28 0.11
29 0.1
30 0.1
31 0.08
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.09
48 0.09
49 0.09
50 0.08
51 0.09
52 0.09
53 0.08
54 0.08
55 0.07
56 0.05
57 0.05
58 0.04
59 0.03
60 0.03
61 0.02
62 0.02
63 0.02
64 0.02
65 0.01
66 0.01
67 0.01
68 0.01
69 0.02
70 0.02
71 0.02
72 0.03
73 0.03
74 0.05
75 0.08
76 0.1
77 0.13
78 0.18
79 0.26
80 0.36
81 0.44
82 0.53
83 0.61
84 0.7
85 0.72
86 0.77
87 0.79
88 0.76
89 0.76
90 0.76
91 0.76
92 0.77