Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8A786

Protein Details
Accession A0A1S8A786   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31ATARTRPITRKEHRERKPVEBasic
NLS Segment(s)
Subcellular Location(s) mito 8, plas 6, cyto_mito 6, cyto 4, pero 4, cyto_pero 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAAGRDNNGQNATARTRPITRKEHRERKPVELVRAGRRSVDGGTLVWLYVDDANVVVVGVVVVVVVVVHSEEGESQPQKIASIN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.33
4 0.38
5 0.45
6 0.5
7 0.54
8 0.62
9 0.71
10 0.78
11 0.79
12 0.83
13 0.79
14 0.76
15 0.78
16 0.71
17 0.65
18 0.62
19 0.59
20 0.57
21 0.57
22 0.49
23 0.39
24 0.35
25 0.31
26 0.24
27 0.2
28 0.12
29 0.08
30 0.09
31 0.09
32 0.08
33 0.07
34 0.06
35 0.06
36 0.05
37 0.05
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.03
57 0.03
58 0.04
59 0.06
60 0.12
61 0.13
62 0.14
63 0.17
64 0.17