Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S7UJP6

Protein Details
Accession A0A1S7UJP6    Localization Confidence High Confidence Score 18.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-37GMRKNGKQWHTPRKAFRPTAHydrophilic
91-117AKMAEKMHKKRVERLKRKEKRNKLLNSBasic
NLS Segment(s)
PositionSequence
55-113MKAKEKEMKEEKETERQQRVQKIKDKRAAKEEKERYAKMAEKMHKKRVERLKRKEKRNK
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005730  C:nucleolus  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MSAETATGGAKAQEPLQGMRKNGKQWHTPRKAFRPTAGLTSFEQREKRRLAMVVMKAKEKEMKEEKETERQQRVQKIKDKRAAKEEKERYAKMAEKMHKKRVERLKRKEKRNKLLNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.19
3 0.27
4 0.3
5 0.3
6 0.37
7 0.41
8 0.45
9 0.5
10 0.52
11 0.53
12 0.6
13 0.69
14 0.71
15 0.73
16 0.75
17 0.78
18 0.81
19 0.74
20 0.67
21 0.63
22 0.55
23 0.54
24 0.46
25 0.39
26 0.31
27 0.33
28 0.32
29 0.29
30 0.33
31 0.28
32 0.32
33 0.32
34 0.32
35 0.3
36 0.29
37 0.28
38 0.29
39 0.34
40 0.35
41 0.34
42 0.34
43 0.32
44 0.32
45 0.33
46 0.27
47 0.28
48 0.28
49 0.31
50 0.32
51 0.39
52 0.41
53 0.46
54 0.51
55 0.51
56 0.51
57 0.53
58 0.55
59 0.57
60 0.61
61 0.59
62 0.62
63 0.65
64 0.67
65 0.7
66 0.7
67 0.66
68 0.7
69 0.71
70 0.69
71 0.7
72 0.69
73 0.7
74 0.71
75 0.67
76 0.59
77 0.56
78 0.55
79 0.5
80 0.52
81 0.5
82 0.54
83 0.61
84 0.68
85 0.7
86 0.68
87 0.72
88 0.74
89 0.77
90 0.77
91 0.8
92 0.82
93 0.84
94 0.92
95 0.94
96 0.94
97 0.93