Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TVM6

Protein Details
Accession A0A1W2TVM6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
39-66NQEGRMSSKKPKKSTKKDKEKRQGEDLLBasic
NLS Segment(s)
PositionSequence
46-60SKKPKKSTKKDKEKR
Subcellular Location(s) mito 13, cyto_nucl 8, nucl 7, cyto 7
Family & Domain DBs
Amino Acid Sequences MSSAKSSGNVVGSAAATAGSQKLSLSDYNSFTSMTSPSNQEGRMSSKKPKKSTKKDKEKRQGEDLLGIGAQFESH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.07
3 0.05
4 0.06
5 0.06
6 0.05
7 0.05
8 0.05
9 0.06
10 0.08
11 0.09
12 0.12
13 0.14
14 0.17
15 0.18
16 0.19
17 0.18
18 0.16
19 0.16
20 0.14
21 0.12
22 0.11
23 0.11
24 0.12
25 0.14
26 0.14
27 0.14
28 0.14
29 0.2
30 0.24
31 0.26
32 0.34
33 0.4
34 0.48
35 0.56
36 0.65
37 0.7
38 0.75
39 0.84
40 0.86
41 0.89
42 0.92
43 0.94
44 0.95
45 0.93
46 0.88
47 0.85
48 0.8
49 0.71
50 0.65
51 0.54
52 0.44
53 0.34
54 0.27
55 0.19