Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TQL6

Protein Details
Accession A0A1W2TQL6   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-40YTILYQQTRRRDVKRCKHIKPDSAREFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006311  TAT_signal  
PROSITE View protein in PROSITE  
PS51318  TAT  
Amino Acid Sequences MNHMTSSRRLDDYTILYQQTRRRDVKRCKHIKPDSAREFLGNVSAYAAAAAAATAAATATAAAATAATKLGRAFRLVASPPTTDGPSQNPILDARHWKLLTNNPFRMKSSPAKTPPRSLFAMGLSIGLGKTFVDAQMHNCIPPYAVLRSSGRDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.31
4 0.35
5 0.38
6 0.42
7 0.45
8 0.47
9 0.5
10 0.59
11 0.69
12 0.75
13 0.81
14 0.82
15 0.82
16 0.85
17 0.87
18 0.86
19 0.85
20 0.85
21 0.81
22 0.75
23 0.67
24 0.57
25 0.49
26 0.39
27 0.32
28 0.22
29 0.14
30 0.11
31 0.1
32 0.09
33 0.08
34 0.08
35 0.04
36 0.04
37 0.03
38 0.02
39 0.02
40 0.02
41 0.02
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.03
53 0.03
54 0.03
55 0.04
56 0.05
57 0.07
58 0.07
59 0.08
60 0.09
61 0.09
62 0.12
63 0.13
64 0.14
65 0.15
66 0.14
67 0.15
68 0.15
69 0.15
70 0.13
71 0.13
72 0.14
73 0.15
74 0.16
75 0.15
76 0.14
77 0.14
78 0.15
79 0.17
80 0.19
81 0.18
82 0.24
83 0.24
84 0.24
85 0.27
86 0.34
87 0.41
88 0.44
89 0.48
90 0.47
91 0.49
92 0.5
93 0.49
94 0.46
95 0.45
96 0.42
97 0.45
98 0.48
99 0.57
100 0.58
101 0.65
102 0.63
103 0.59
104 0.57
105 0.49
106 0.43
107 0.34
108 0.32
109 0.23
110 0.19
111 0.14
112 0.12
113 0.1
114 0.08
115 0.07
116 0.04
117 0.05
118 0.06
119 0.07
120 0.09
121 0.1
122 0.13
123 0.21
124 0.22
125 0.22
126 0.22
127 0.21
128 0.19
129 0.21
130 0.22
131 0.18
132 0.18
133 0.22
134 0.24