Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

C6HD07

Protein Details
Accession C6HD07    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-52EHVSKSELKKRQKHRAKEAEREKRABasic
NLS Segment(s)
PositionSequence
35-62LKKRQKHRAKEAEREKRAAAAPPKAEKK
Subcellular Location(s) cyto 14.5, cyto_nucl 13.333, nucl 11, mito_nucl 6.833
Family & Domain DBs
Gene Ontology GO:0004812  F:aminoacyl-tRNA ligase activity  
Amino Acid Sequences MGGPDQGPATDAAADNLANLHLDEVTGEHVSKSELKKRQKHRAKEAEREKRAAAAPPKAEKKASAEEEESNLTPNVGILRVTIEQFLAEVGVDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.06
6 0.06
7 0.06
8 0.05
9 0.05
10 0.05
11 0.05
12 0.07
13 0.07
14 0.08
15 0.07
16 0.07
17 0.09
18 0.14
19 0.17
20 0.23
21 0.31
22 0.4
23 0.49
24 0.58
25 0.68
26 0.73
27 0.78
28 0.81
29 0.83
30 0.82
31 0.83
32 0.84
33 0.84
34 0.77
35 0.7
36 0.59
37 0.51
38 0.45
39 0.41
40 0.34
41 0.29
42 0.3
43 0.35
44 0.39
45 0.38
46 0.37
47 0.33
48 0.34
49 0.36
50 0.35
51 0.32
52 0.31
53 0.3
54 0.32
55 0.33
56 0.28
57 0.23
58 0.19
59 0.15
60 0.12
61 0.11
62 0.1
63 0.08
64 0.08
65 0.06
66 0.1
67 0.11
68 0.12
69 0.12
70 0.11
71 0.1
72 0.1
73 0.1
74 0.07