Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BKS5

Protein Details
Accession Q6BKS5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MNKEKREKKQKKKKTEDSGIGELIBasic
NLS Segment(s)
PositionSequence
3-14KEKREKKQKKKK
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, cyto 2.5
Family & Domain DBs
KEGG dha:DEHA2F19536g  -  
Amino Acid Sequences MNKEKREKKQKKKKTEDSGIGELIITDNIACDFTYLSSFNMDSLLKEATKSPGQYNKDNKNNKVLAPPKEDQDEESGNVNKLSEAAQRLVHICDSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.94
2 0.94
3 0.91
4 0.88
5 0.81
6 0.7
7 0.59
8 0.48
9 0.37
10 0.27
11 0.17
12 0.09
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.04
19 0.05
20 0.05
21 0.07
22 0.08
23 0.08
24 0.09
25 0.09
26 0.08
27 0.1
28 0.09
29 0.08
30 0.09
31 0.09
32 0.08
33 0.08
34 0.09
35 0.11
36 0.13
37 0.14
38 0.16
39 0.23
40 0.27
41 0.34
42 0.42
43 0.48
44 0.56
45 0.61
46 0.6
47 0.61
48 0.59
49 0.53
50 0.54
51 0.51
52 0.48
53 0.48
54 0.48
55 0.42
56 0.44
57 0.43
58 0.35
59 0.33
60 0.3
61 0.24
62 0.27
63 0.26
64 0.23
65 0.23
66 0.22
67 0.16
68 0.15
69 0.15
70 0.15
71 0.16
72 0.17
73 0.19
74 0.21
75 0.22
76 0.24