Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8ABK5

Protein Details
Accession A0A1S8ABK5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
7-45IFSGARKRDPERKPERKPEREPKREPKRKHAFPNYRGKTBasic
NLS Segment(s)
PositionSequence
11-37ARKRDPERKPERKPEREPKREPKRKHA
Subcellular Location(s) mito 18.5, mito_nucl 13.5, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MHVFLGIFSGARKRDPERKPERKPEREPKREPKRKHAFPNYRGKTNMITGKMTSRQSSAARSALAAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.51
4 0.57
5 0.66
6 0.74
7 0.81
8 0.85
9 0.85
10 0.89
11 0.9
12 0.9
13 0.89
14 0.89
15 0.89
16 0.89
17 0.89
18 0.84
19 0.84
20 0.83
21 0.81
22 0.82
23 0.82
24 0.81
25 0.79
26 0.86
27 0.79
28 0.73
29 0.67
30 0.58
31 0.5
32 0.46
33 0.43
34 0.34
35 0.32
36 0.28
37 0.32
38 0.36
39 0.36
40 0.31
41 0.27
42 0.29
43 0.3
44 0.33
45 0.33
46 0.3
47 0.27
48 0.26