Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TM97

Protein Details
Accession A0A1W2TM97    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-109SRADRQSKQNRSHWKNWRKRFRGTKKPIYPSLSVHydrophilic
NLS Segment(s)
PositionSequence
70-101KRAGLASRADRQSKQNRSHWKNWRKRFRGTKK
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MVVDMVHPNQSAISRSHLEQLLATLYKARPEQISIFGLQTAFKGGKTTGFACIYNSVSARTMFDAKYRLKRAGLASRADRQSKQNRSHWKNWRKRFRGTKKPIYPSLSVRWVTNTPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.26
4 0.26
5 0.25
6 0.23
7 0.22
8 0.21
9 0.18
10 0.17
11 0.16
12 0.15
13 0.19
14 0.19
15 0.19
16 0.16
17 0.19
18 0.21
19 0.21
20 0.23
21 0.2
22 0.2
23 0.18
24 0.18
25 0.15
26 0.12
27 0.11
28 0.09
29 0.08
30 0.09
31 0.08
32 0.1
33 0.12
34 0.13
35 0.15
36 0.16
37 0.16
38 0.16
39 0.18
40 0.17
41 0.16
42 0.15
43 0.12
44 0.11
45 0.11
46 0.11
47 0.1
48 0.11
49 0.1
50 0.12
51 0.16
52 0.19
53 0.26
54 0.29
55 0.3
56 0.28
57 0.32
58 0.35
59 0.39
60 0.39
61 0.36
62 0.37
63 0.42
64 0.46
65 0.45
66 0.42
67 0.42
68 0.48
69 0.52
70 0.56
71 0.57
72 0.64
73 0.69
74 0.77
75 0.8
76 0.81
77 0.82
78 0.86
79 0.89
80 0.83
81 0.86
82 0.87
83 0.87
84 0.88
85 0.87
86 0.88
87 0.86
88 0.89
89 0.86
90 0.81
91 0.74
92 0.69
93 0.66
94 0.63
95 0.54
96 0.47
97 0.45