Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8A553

Protein Details
Accession A0A1S8A553    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
8-36SDAPRSIVFRGKKRKTYRQRSGTKPDTENHydrophilic
NLS Segment(s)
PositionSequence
19-22KKRK
Subcellular Location(s) mito 16, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Gene Ontology GO:0004386  F:helicase activity  
Amino Acid Sequences MAPSSPISDAPRSIVFRGKKRKTYRQRSGTKPDTENDASTMPVDPVLDAPNVVNTQDPTPDTVAASADKGHDEVLSISDALRFRHSRRPRLRGVTFGVDHSIQAGSTQADDELSQMIREEEKKAIEQSITTANRRFAPQTGLSGEMVNRHM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.45
4 0.55
5 0.61
6 0.65
7 0.72
8 0.81
9 0.84
10 0.88
11 0.89
12 0.89
13 0.89
14 0.89
15 0.89
16 0.87
17 0.83
18 0.75
19 0.66
20 0.63
21 0.56
22 0.47
23 0.39
24 0.31
25 0.24
26 0.21
27 0.2
28 0.12
29 0.1
30 0.09
31 0.07
32 0.07
33 0.08
34 0.08
35 0.07
36 0.07
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.11
44 0.11
45 0.11
46 0.12
47 0.12
48 0.11
49 0.1
50 0.1
51 0.09
52 0.09
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.06
62 0.06
63 0.05
64 0.05
65 0.08
66 0.08
67 0.09
68 0.13
69 0.14
70 0.17
71 0.27
72 0.34
73 0.42
74 0.5
75 0.57
76 0.6
77 0.67
78 0.66
79 0.61
80 0.58
81 0.54
82 0.45
83 0.39
84 0.34
85 0.25
86 0.23
87 0.19
88 0.14
89 0.08
90 0.07
91 0.08
92 0.06
93 0.06
94 0.06
95 0.05
96 0.06
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.07
103 0.08
104 0.1
105 0.12
106 0.14
107 0.15
108 0.17
109 0.19
110 0.21
111 0.22
112 0.2
113 0.19
114 0.19
115 0.26
116 0.28
117 0.29
118 0.31
119 0.32
120 0.34
121 0.37
122 0.37
123 0.3
124 0.32
125 0.31
126 0.33
127 0.32
128 0.32
129 0.3
130 0.29
131 0.27