Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S7UMQ1

Protein Details
Accession A0A1S7UMQ1   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
41-60MHPPRPKKKKEHSTDPYLRDBasic
NLS Segment(s)
PositionSequence
44-50PRPKKKK
Subcellular Location(s) nucl 10, mito 8, cyto 4, extr 3
Family & Domain DBs
Gene Ontology GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
Amino Acid Sequences MNAVAASSAAAAAAAAAASTSSVSSAHTSDPATRRSSNVIMHPPRPKKKKEHSTDPYLRDFTLVAEAARRAQMSIMLRDMENVGLSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.03
8 0.03
9 0.04
10 0.05
11 0.07
12 0.08
13 0.09
14 0.1
15 0.11
16 0.16
17 0.19
18 0.21
19 0.24
20 0.24
21 0.25
22 0.27
23 0.29
24 0.26
25 0.28
26 0.34
27 0.33
28 0.38
29 0.45
30 0.49
31 0.55
32 0.59
33 0.6
34 0.61
35 0.69
36 0.74
37 0.74
38 0.76
39 0.74
40 0.78
41 0.81
42 0.75
43 0.69
44 0.6
45 0.51
46 0.41
47 0.34
48 0.24
49 0.2
50 0.16
51 0.11
52 0.11
53 0.12
54 0.13
55 0.14
56 0.13
57 0.1
58 0.1
59 0.15
60 0.17
61 0.19
62 0.2
63 0.2
64 0.2
65 0.21
66 0.22
67 0.17
68 0.15