Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S7UKE8

Protein Details
Accession A0A1S7UKE8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
57-88YIHFATMKPEQKKKKEKKADEKKPGAKPPAQRBasic
NLS Segment(s)
PositionSequence
66-88EQKKKKEKKADEKKPGAKPPAQR
Subcellular Location(s) mito 8, E.R. 6, plas 4, extr 3, cyto 2, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTPQRSGRADSGQFNFLGKIGATPEAVATLNDQPHVFYVLVGALVVLILQGLFIWYIHFATMKPEQKKKKEKKADEKKPGAKPPAQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.35
3 0.3
4 0.22
5 0.19
6 0.12
7 0.1
8 0.09
9 0.1
10 0.09
11 0.09
12 0.09
13 0.09
14 0.09
15 0.08
16 0.09
17 0.11
18 0.11
19 0.12
20 0.12
21 0.11
22 0.11
23 0.13
24 0.11
25 0.08
26 0.07
27 0.07
28 0.06
29 0.06
30 0.05
31 0.03
32 0.02
33 0.02
34 0.02
35 0.01
36 0.01
37 0.01
38 0.01
39 0.02
40 0.02
41 0.02
42 0.03
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.1
49 0.18
50 0.26
51 0.32
52 0.41
53 0.5
54 0.6
55 0.72
56 0.78
57 0.81
58 0.84
59 0.88
60 0.91
61 0.93
62 0.94
63 0.94
64 0.94
65 0.92
66 0.91
67 0.89
68 0.85