Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8A4P5

Protein Details
Accession A0A1S8A4P5    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
70-96SPETHRGIRRRPAPHRKLARRQPGAYLBasic
NLS Segment(s)
PositionSequence
75-90RGIRRRPAPHRKLARR
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MAAASPLVQATRHSTPTGIPPERKTSSSSSSSSWLRSIFRLSIFGSPRAPPKATQDLGFPGQHAVVELGSPETHRGIRRRPAPHRKLARRQPGAYLSLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.31
4 0.39
5 0.38
6 0.38
7 0.4
8 0.47
9 0.5
10 0.49
11 0.45
12 0.4
13 0.4
14 0.4
15 0.38
16 0.32
17 0.34
18 0.34
19 0.32
20 0.28
21 0.24
22 0.21
23 0.21
24 0.21
25 0.18
26 0.17
27 0.18
28 0.17
29 0.21
30 0.21
31 0.22
32 0.21
33 0.2
34 0.23
35 0.24
36 0.24
37 0.19
38 0.23
39 0.29
40 0.28
41 0.28
42 0.26
43 0.26
44 0.28
45 0.27
46 0.21
47 0.14
48 0.13
49 0.12
50 0.11
51 0.08
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.08
60 0.12
61 0.17
62 0.22
63 0.29
64 0.38
65 0.46
66 0.55
67 0.64
68 0.72
69 0.76
70 0.81
71 0.85
72 0.86
73 0.89
74 0.89
75 0.9
76 0.87
77 0.81
78 0.78
79 0.73