Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S7UJA9

Protein Details
Accession A0A1S7UJA9    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-36SNKASKTSKSRTGTKKPRQEPRTTNNKTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MSPQTSTASNKASKTSKSRTGTKKPRQEPRTTNNKTGAQGGEQNTETGDTDNKIGAQGGEQNTETGDTNNKTGAQGGEQKPGAQGQSKTRKGQSYYFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.54
4 0.56
5 0.64
6 0.67
7 0.74
8 0.79
9 0.81
10 0.84
11 0.83
12 0.88
13 0.85
14 0.85
15 0.83
16 0.8
17 0.81
18 0.76
19 0.73
20 0.69
21 0.66
22 0.57
23 0.51
24 0.43
25 0.33
26 0.32
27 0.28
28 0.24
29 0.21
30 0.2
31 0.16
32 0.16
33 0.14
34 0.1
35 0.09
36 0.06
37 0.07
38 0.07
39 0.07
40 0.06
41 0.06
42 0.05
43 0.05
44 0.1
45 0.1
46 0.12
47 0.12
48 0.12
49 0.12
50 0.13
51 0.13
52 0.09
53 0.12
54 0.12
55 0.13
56 0.14
57 0.14
58 0.14
59 0.15
60 0.15
61 0.14
62 0.22
63 0.24
64 0.29
65 0.29
66 0.29
67 0.29
68 0.3
69 0.28
70 0.24
71 0.26
72 0.3
73 0.41
74 0.47
75 0.52
76 0.56
77 0.61
78 0.59