Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8A5H8

Protein Details
Accession A0A1S8A5H8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
70-97EEEEKKEKEKEKEKEKEKEKEKEKGQKKBasic
NLS Segment(s)
PositionSequence
74-97KKEKEKEKEKEKEKEKEKEKGQKK
Subcellular Location(s) cyto_nucl 11.5, cyto 11, nucl 8, mito 5
Family & Domain DBs
Amino Acid Sequences MAENSGRGNIIDAGEDAPRGGDVAPPPVADDVKAAVAGGAAAAGDVTGVHASGREAGMRPDPTTGVVRAEEEEKKEKEKEKEKEKEKEKEKEKGQKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.09
4 0.08
5 0.07
6 0.07
7 0.06
8 0.08
9 0.08
10 0.12
11 0.13
12 0.13
13 0.14
14 0.14
15 0.14
16 0.12
17 0.11
18 0.09
19 0.08
20 0.08
21 0.07
22 0.05
23 0.05
24 0.05
25 0.04
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.03
39 0.04
40 0.04
41 0.05
42 0.05
43 0.07
44 0.11
45 0.12
46 0.13
47 0.13
48 0.13
49 0.14
50 0.16
51 0.16
52 0.14
53 0.13
54 0.13
55 0.14
56 0.17
57 0.17
58 0.2
59 0.26
60 0.26
61 0.3
62 0.34
63 0.4
64 0.46
65 0.54
66 0.59
67 0.63
68 0.72
69 0.77
70 0.82
71 0.84
72 0.85
73 0.84
74 0.85
75 0.82
76 0.81
77 0.82