Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8A9T5

Protein Details
Accession A0A1S8A9T5    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
31-59ATGVIMKKRKKGKNRSPPRKSKQAKERSTBasic
NLS Segment(s)
PositionSequence
17-57QRRVAPRIKGRHTKATGVIMKKRKKGKNRSPPRKSKQAKER
Subcellular Location(s) nucl 22, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MLRDERESERSASKVLQRRVAPRIKGRHTKATGVIMKKRKKGKNRSPPRKSKQAKERSTPGNNGAMIPYKGRIETPPNPNAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.46
4 0.46
5 0.51
6 0.57
7 0.61
8 0.59
9 0.59
10 0.63
11 0.65
12 0.7
13 0.69
14 0.7
15 0.66
16 0.63
17 0.57
18 0.56
19 0.53
20 0.48
21 0.51
22 0.49
23 0.52
24 0.55
25 0.61
26 0.61
27 0.65
28 0.71
29 0.75
30 0.77
31 0.83
32 0.88
33 0.89
34 0.92
35 0.9
36 0.9
37 0.85
38 0.84
39 0.83
40 0.82
41 0.8
42 0.76
43 0.77
44 0.75
45 0.74
46 0.68
47 0.6
48 0.55
49 0.47
50 0.41
51 0.35
52 0.3
53 0.25
54 0.23
55 0.21
56 0.18
57 0.18
58 0.19
59 0.22
60 0.26
61 0.33
62 0.4