Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8AAC6

Protein Details
Accession A0A1S8AAC6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-38MSFTLARKRSRPRQREPWDQEQGHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 7, extr 6, E.R. 4
Family & Domain DBs
Amino Acid Sequences MQPPASAVLAACSIEMSFTLARKRSRPRQREPWDQEQGPFPDIAGSVLVSCSAQTTAANRIPPVAMATVAIATVTFVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.08
4 0.08
5 0.1
6 0.16
7 0.2
8 0.24
9 0.31
10 0.4
11 0.48
12 0.58
13 0.65
14 0.69
15 0.75
16 0.81
17 0.85
18 0.84
19 0.83
20 0.79
21 0.71
22 0.63
23 0.56
24 0.48
25 0.38
26 0.3
27 0.2
28 0.13
29 0.12
30 0.11
31 0.07
32 0.05
33 0.04
34 0.04
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.07
43 0.14
44 0.17
45 0.18
46 0.18
47 0.19
48 0.18
49 0.18
50 0.18
51 0.13
52 0.1
53 0.09
54 0.1
55 0.08
56 0.08
57 0.07
58 0.05
59 0.05