Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8A9P7

Protein Details
Accession A0A1S8A9P7   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-100RDLAPVRRLDGKKRKPNQSCTHTLYLHydrophilic
NLS Segment(s)
PositionSequence
85-88GKKR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 6, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPAGRQRSSNWAASWDGILYQYGAVGRVGSGSAIPDPAQSNTSNESNKRLSRTPSALLANSAAYITRSHHAPRSRDLAPVRRLDGKKRKPNQSCTHTLYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.22
3 0.17
4 0.13
5 0.12
6 0.09
7 0.08
8 0.07
9 0.07
10 0.07
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.07
23 0.08
24 0.09
25 0.11
26 0.11
27 0.12
28 0.15
29 0.18
30 0.2
31 0.19
32 0.23
33 0.26
34 0.27
35 0.29
36 0.29
37 0.29
38 0.31
39 0.33
40 0.3
41 0.3
42 0.3
43 0.26
44 0.24
45 0.21
46 0.16
47 0.13
48 0.12
49 0.07
50 0.06
51 0.07
52 0.08
53 0.09
54 0.11
55 0.13
56 0.2
57 0.26
58 0.29
59 0.33
60 0.37
61 0.36
62 0.41
63 0.45
64 0.47
65 0.47
66 0.48
67 0.47
68 0.5
69 0.52
70 0.56
71 0.62
72 0.64
73 0.69
74 0.74
75 0.81
76 0.81
77 0.89
78 0.89
79 0.86
80 0.84