Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TUZ4

Protein Details
Accession A0A1W2TUZ4    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
91-110DPTVRWTIKHYKKQDRYDVYHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, cyto_nucl 5.5, cyto 5, nucl 4, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035992  Ricin_B-like_lectins  
IPR000772  Ricin_B_lectin  
Pfam View protein in Pfam  
PF14200  RicinB_lectin_2  
Amino Acid Sequences MVFNGAGIYSIVSYQGPDNNINSWGGGTTLGQPVKLYPKNPLTSNAKWQVALINGSGESAQYLIINLANGGYLTATGKNQVTSCQFKLPTDPTVRWTIKHYKKQDRYDVYTVNSVSANGQLNAEASGTAVGTNVLSWQIENGDNTMWYFDAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.13
3 0.15
4 0.17
5 0.18
6 0.19
7 0.2
8 0.2
9 0.18
10 0.15
11 0.12
12 0.1
13 0.09
14 0.08
15 0.1
16 0.15
17 0.15
18 0.15
19 0.15
20 0.16
21 0.25
22 0.27
23 0.26
24 0.27
25 0.35
26 0.39
27 0.4
28 0.45
29 0.43
30 0.44
31 0.52
32 0.51
33 0.44
34 0.41
35 0.39
36 0.35
37 0.29
38 0.26
39 0.17
40 0.11
41 0.1
42 0.1
43 0.1
44 0.07
45 0.05
46 0.04
47 0.04
48 0.03
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.06
64 0.06
65 0.07
66 0.08
67 0.1
68 0.14
69 0.17
70 0.19
71 0.22
72 0.22
73 0.22
74 0.26
75 0.26
76 0.28
77 0.27
78 0.27
79 0.26
80 0.33
81 0.34
82 0.3
83 0.33
84 0.38
85 0.44
86 0.52
87 0.59
88 0.61
89 0.7
90 0.77
91 0.81
92 0.78
93 0.76
94 0.72
95 0.66
96 0.58
97 0.53
98 0.45
99 0.36
100 0.29
101 0.22
102 0.17
103 0.17
104 0.16
105 0.12
106 0.12
107 0.11
108 0.12
109 0.12
110 0.11
111 0.07
112 0.06
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.04
119 0.04
120 0.05
121 0.06
122 0.06
123 0.06
124 0.07
125 0.09
126 0.11
127 0.12
128 0.13
129 0.13
130 0.13
131 0.14
132 0.14
133 0.12