Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8A8I4

Protein Details
Accession A0A1S8A8I4    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
35-64GRLMDPRARRRPPRWRRKRRRPLAVNDLNQBasic
NLS Segment(s)
PositionSequence
32-56KAAGRLMDPRARRRPPRWRRKRRRP
Subcellular Location(s) nucl 16, extr 6, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MCSSSPSDPAPLAPTILQAAPIARGGRYNLPKAAGRLMDPRARRRPPRWRRKRRRPLAVNDLNQDDFNTGYLLNGRRTALANDRAKPTASLSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.15
4 0.14
5 0.11
6 0.11
7 0.1
8 0.13
9 0.12
10 0.1
11 0.12
12 0.13
13 0.21
14 0.25
15 0.27
16 0.26
17 0.28
18 0.29
19 0.29
20 0.31
21 0.23
22 0.21
23 0.23
24 0.25
25 0.28
26 0.3
27 0.37
28 0.42
29 0.48
30 0.54
31 0.58
32 0.65
33 0.71
34 0.78
35 0.82
36 0.84
37 0.89
38 0.93
39 0.96
40 0.95
41 0.95
42 0.92
43 0.9
44 0.9
45 0.87
46 0.8
47 0.71
48 0.64
49 0.53
50 0.45
51 0.36
52 0.25
53 0.16
54 0.13
55 0.1
56 0.07
57 0.06
58 0.11
59 0.13
60 0.14
61 0.16
62 0.16
63 0.17
64 0.19
65 0.23
66 0.26
67 0.33
68 0.37
69 0.4
70 0.44
71 0.44
72 0.44
73 0.41
74 0.39