Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1W2TQB8

Protein Details
Accession A0A1W2TQB8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
47-75PQPPSYPPRNGHRRRRRRRRGHKLSEFELBasic
NLS Segment(s)
PositionSequence
54-69PRNGHRRRRRRRRGHK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 6, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLQSSTKLNPLSAPFYPAWDKGQPQLNQPAEPSNTAPEVQYPLYPLPQPPSYPPRNGHRRRRRRRRGHKLSEFELNKAPQQPSYANFPPRKKHWAGATNIAPLTPVLCVHGADAMGIPIIRWCTECYIPGLSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.29
3 0.32
4 0.3
5 0.31
6 0.29
7 0.3
8 0.31
9 0.39
10 0.36
11 0.38
12 0.46
13 0.43
14 0.4
15 0.4
16 0.4
17 0.33
18 0.33
19 0.29
20 0.22
21 0.21
22 0.2
23 0.19
24 0.15
25 0.17
26 0.15
27 0.14
28 0.14
29 0.14
30 0.15
31 0.16
32 0.16
33 0.17
34 0.18
35 0.19
36 0.22
37 0.28
38 0.3
39 0.35
40 0.38
41 0.43
42 0.52
43 0.6
44 0.67
45 0.7
46 0.77
47 0.84
48 0.91
49 0.93
50 0.93
51 0.95
52 0.96
53 0.96
54 0.95
55 0.94
56 0.88
57 0.79
58 0.77
59 0.66
60 0.57
61 0.5
62 0.39
63 0.32
64 0.3
65 0.28
66 0.19
67 0.21
68 0.21
69 0.19
70 0.26
71 0.29
72 0.33
73 0.4
74 0.44
75 0.48
76 0.51
77 0.57
78 0.51
79 0.51
80 0.53
81 0.53
82 0.53
83 0.55
84 0.53
85 0.49
86 0.46
87 0.41
88 0.32
89 0.24
90 0.2
91 0.12
92 0.09
93 0.07
94 0.08
95 0.08
96 0.08
97 0.1
98 0.09
99 0.09
100 0.09
101 0.07
102 0.07
103 0.07
104 0.06
105 0.07
106 0.09
107 0.09
108 0.1
109 0.12
110 0.17
111 0.19
112 0.21
113 0.22