Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C6HI18

Protein Details
Accession C6HI18   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-40VSVKLEKKARRRVFPQRDHVVHydrophilic
NLS Segment(s)
PositionSequence
27-29KAR
Subcellular Location(s) nucl 9.5, mito 9, cyto_nucl 9, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MAFIQGTECFVSVTSPRKIVSVKLEKKARRRVFPQRDHVVVRQPIRRLDQVVVRVIGMLTPWDRRTCERGVHVRGAGPTPHTINQRRKWKDLLLLSASSTVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.23
4 0.25
5 0.26
6 0.28
7 0.34
8 0.39
9 0.43
10 0.5
11 0.58
12 0.62
13 0.71
14 0.78
15 0.75
16 0.72
17 0.73
18 0.76
19 0.78
20 0.81
21 0.8
22 0.75
23 0.72
24 0.68
25 0.61
26 0.58
27 0.52
28 0.48
29 0.43
30 0.39
31 0.38
32 0.38
33 0.38
34 0.32
35 0.28
36 0.27
37 0.26
38 0.24
39 0.21
40 0.18
41 0.16
42 0.14
43 0.12
44 0.08
45 0.06
46 0.06
47 0.08
48 0.1
49 0.11
50 0.13
51 0.16
52 0.21
53 0.23
54 0.26
55 0.31
56 0.38
57 0.41
58 0.43
59 0.41
60 0.39
61 0.37
62 0.35
63 0.29
64 0.23
65 0.21
66 0.21
67 0.24
68 0.3
69 0.37
70 0.45
71 0.53
72 0.62
73 0.66
74 0.67
75 0.68
76 0.66
77 0.66
78 0.63
79 0.61
80 0.55
81 0.5
82 0.46