Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6BW08

Protein Details
Accession Q6BW08    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-26HTAHNQTKKAHRNGIKKPRSBasic
NLS Segment(s)
PositionSequence
14-59KKAHRNGIKKPRSHKYPSLKGVDAKFRRNHRYALHGTAKALAKARA
Subcellular Location(s) nucl 22, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG dha:DEHA2B15224g  -  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTAHNQTKKAHRNGIKKPRSHKYPSLKGVDAKFRRNHRYALHGTAKALAKARAEKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.76
3 0.75
4 0.73
5 0.72
6 0.75
7 0.8
8 0.79
9 0.76
10 0.77
11 0.77
12 0.76
13 0.73
14 0.71
15 0.7
16 0.72
17 0.72
18 0.68
19 0.61
20 0.57
21 0.53
22 0.54
23 0.48
24 0.46
25 0.46
26 0.49
27 0.54
28 0.53
29 0.55
30 0.48
31 0.53
32 0.5
33 0.53
34 0.52
35 0.46
36 0.44
37 0.45
38 0.44
39 0.38
40 0.36
41 0.3
42 0.28
43 0.34