Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TJB8

Protein Details
Accession A0A1W2TJB8   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-23DSVTLRTRKFQRNPLLGRKQMHydrophilic
96-126LATKVERASRQQRKQRKNRMKTLRGTEKTKGHydrophilic
NLS Segment(s)
PositionSequence
83-133KKFDAKHRLIRAGLATKVERASRQQRKQRKNRMKTLRGTEKTKGKKAKKDS
Subcellular Location(s) mito 15.5, cyto_mito 11, cyto 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MADSVTLRTRKFQRNPLLGRKQMVADIIHPDQAGISKANLQEKLASLYKATPEQVSVFGLRTAFGGGKTTAFACIYDSVEARKKFDAKHRLIRAGLATKVERASRQQRKQRKNRMKTLRGTEKTKGKKAKKDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.82
4 0.83
5 0.77
6 0.72
7 0.64
8 0.55
9 0.46
10 0.4
11 0.3
12 0.22
13 0.23
14 0.22
15 0.21
16 0.19
17 0.17
18 0.15
19 0.15
20 0.15
21 0.1
22 0.09
23 0.12
24 0.15
25 0.19
26 0.19
27 0.19
28 0.19
29 0.19
30 0.23
31 0.21
32 0.18
33 0.15
34 0.16
35 0.17
36 0.17
37 0.17
38 0.12
39 0.12
40 0.13
41 0.13
42 0.13
43 0.11
44 0.1
45 0.1
46 0.1
47 0.09
48 0.08
49 0.08
50 0.07
51 0.06
52 0.07
53 0.07
54 0.07
55 0.07
56 0.07
57 0.07
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.11
66 0.18
67 0.19
68 0.19
69 0.21
70 0.23
71 0.26
72 0.35
73 0.42
74 0.42
75 0.52
76 0.55
77 0.57
78 0.55
79 0.53
80 0.48
81 0.42
82 0.36
83 0.3
84 0.25
85 0.23
86 0.25
87 0.24
88 0.22
89 0.25
90 0.35
91 0.42
92 0.51
93 0.6
94 0.68
95 0.78
96 0.87
97 0.91
98 0.91
99 0.91
100 0.92
101 0.93
102 0.91
103 0.9
104 0.89
105 0.89
106 0.85
107 0.81
108 0.78
109 0.78
110 0.78
111 0.78
112 0.78
113 0.76