Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1S8A896

Protein Details
Accession A0A1S8A896    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
52-73RFHTNWTRKKQLRKDIEDPKIHBasic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.833, mito 11.5, nucl 11, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR010686  OBAP-like  
Pfam View protein in Pfam  
PF06884  DUF1264  
Amino Acid Sequences MKHIIRLYGKAYHLWQIDRGDKLPLDGPKLMTSFTADGQFDFEKAVGERDQRFHTNWTRKKQLRKDIEDPKIHEDSDFSWKVRRNSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.32
4 0.35
5 0.35
6 0.33
7 0.3
8 0.27
9 0.27
10 0.27
11 0.24
12 0.23
13 0.22
14 0.23
15 0.22
16 0.22
17 0.21
18 0.16
19 0.16
20 0.14
21 0.13
22 0.14
23 0.12
24 0.11
25 0.14
26 0.13
27 0.11
28 0.1
29 0.09
30 0.07
31 0.07
32 0.09
33 0.08
34 0.11
35 0.13
36 0.15
37 0.19
38 0.21
39 0.22
40 0.26
41 0.34
42 0.41
43 0.47
44 0.53
45 0.6
46 0.64
47 0.73
48 0.77
49 0.78
50 0.78
51 0.79
52 0.8
53 0.8
54 0.83
55 0.79
56 0.74
57 0.7
58 0.62
59 0.53
60 0.44
61 0.35
62 0.29
63 0.32
64 0.31
65 0.26
66 0.3
67 0.36