Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8AAU0

Protein Details
Accession A0A1S8AAU0    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-46DLADRIERRLRKRERKRHRLRKRIKNRRTPEPESPBasic
NLS Segment(s)
PositionSequence
18-41ERRLRKRERKRHRLRKRIKNRRTP
70-74RPKPR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, mito 4
Family & Domain DBs
Amino Acid Sequences MMGAAMSKAIEDLADRIERRLRKRERKRHRLRKRIKNRRTPEPESPEPPEFPVMTKSELRAILARPLLPRPKPRNVGRRGLPLYPTGRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.18
4 0.24
5 0.3
6 0.36
7 0.45
8 0.52
9 0.59
10 0.7
11 0.79
12 0.84
13 0.89
14 0.94
15 0.95
16 0.96
17 0.96
18 0.95
19 0.95
20 0.96
21 0.95
22 0.94
23 0.93
24 0.89
25 0.88
26 0.86
27 0.82
28 0.8
29 0.77
30 0.71
31 0.64
32 0.62
33 0.53
34 0.45
35 0.39
36 0.31
37 0.23
38 0.2
39 0.19
40 0.15
41 0.16
42 0.17
43 0.17
44 0.19
45 0.19
46 0.19
47 0.18
48 0.18
49 0.2
50 0.21
51 0.22
52 0.2
53 0.26
54 0.32
55 0.36
56 0.45
57 0.48
58 0.56
59 0.63
60 0.71
61 0.74
62 0.74
63 0.78
64 0.74
65 0.77
66 0.72
67 0.67
68 0.59
69 0.56