Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1W2TEP7

Protein Details
Accession A0A1W2TEP7    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MVAKHIPIVKKKTKKFNRHQSDRFKCLSHydrophilic
NLS Segment(s)
PositionSequence
11-15KKTKK
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAKHIPIVKKKTKKFNRHQSDRFKCLSTSWRKPKGIDNAVRRRFRGRMAMPSIGYGSNRKTRHMAPNGLKAFIVNNTKDVELLLMHKDTYAAEIAHNVSSRKRIDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.9
4 0.91
5 0.91
6 0.93
7 0.93
8 0.91
9 0.87
10 0.79
11 0.7
12 0.59
13 0.52
14 0.53
15 0.51
16 0.53
17 0.56
18 0.62
19 0.62
20 0.64
21 0.68
22 0.68
23 0.68
24 0.66
25 0.66
26 0.67
27 0.74
28 0.75
29 0.68
30 0.62
31 0.55
32 0.5
33 0.49
34 0.42
35 0.42
36 0.44
37 0.45
38 0.41
39 0.39
40 0.36
41 0.27
42 0.25
43 0.18
44 0.16
45 0.21
46 0.21
47 0.22
48 0.24
49 0.28
50 0.36
51 0.39
52 0.44
53 0.4
54 0.49
55 0.48
56 0.45
57 0.41
58 0.32
59 0.27
60 0.24
61 0.24
62 0.14
63 0.15
64 0.16
65 0.16
66 0.16
67 0.15
68 0.11
69 0.08
70 0.09
71 0.1
72 0.09
73 0.09
74 0.09
75 0.09
76 0.08
77 0.09
78 0.09
79 0.07
80 0.07
81 0.09
82 0.11
83 0.12
84 0.14
85 0.13
86 0.14
87 0.2
88 0.21
89 0.21
90 0.22
91 0.23
92 0.28
93 0.36
94 0.43
95 0.46
96 0.49
97 0.47
98 0.46
99 0.45
100 0.42
101 0.38
102 0.32
103 0.28
104 0.3
105 0.35
106 0.41
107 0.4
108 0.4
109 0.37