Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1S8A5D6

Protein Details
Accession A0A1S8A5D6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-69HAMPSEQKAWQRKKKRSPRPGBasic
NLS Segment(s)
PositionSequence
59-69QRKKKRSPRPG
Subcellular Location(s) extr 13, plas 5, mito 4, E.R. 4
Family & Domain DBs
Amino Acid Sequences MIKYCWLVVAGCWLLALLVAAAGPVVVMYGFSWRGWIRNGAQAAWVVLHAMPSEQKAWQRKKKRSPRPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.03
5 0.03
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.04
17 0.05
18 0.05
19 0.07
20 0.08
21 0.09
22 0.1
23 0.13
24 0.13
25 0.17
26 0.18
27 0.16
28 0.17
29 0.16
30 0.15
31 0.13
32 0.11
33 0.07
34 0.06
35 0.06
36 0.05
37 0.06
38 0.07
39 0.08
40 0.1
41 0.12
42 0.19
43 0.29
44 0.39
45 0.49
46 0.59
47 0.68
48 0.78
49 0.86